Parsing Genbank File: Get Locus Tag VS Prodotto
Domanda
Fondamentalmente, un file Genbank consiste sulle voci geni (annunciate da "Gene" seguite dalla corrispondente voce "CDS" (solo una per genice) come i due che mostro qui qui sotto. Mi piacerebbe ottenere il prodotto locus_tag vs in aTab -imited Due colonne file. 'Gene' e 'CDS' sono sempre preceduti e seguiti da spazi.
Una domanda precedente ha suggerito uno script.
Il problema è che sembra che, poiché "Prodotto" ha un carattere a volte "/ 'nel suo nome, è il suo conflitto con questo script, che, per quanto posso capire, sta usando' / 'come separatore di campo da memorizzareinformazioni in un array?
Vorrei risolvere questo, o modificando questo script o costruendo altro.
perl -nE'
BEGIN{ ($/, $") = ("CDS", "\t") }
say "@r[0,1]" if @r= m!/(?:locus_tag|product)="(.+?)"!g and @r>1
' file
gene complement(8972..9094)
/locus_tag="HAPS_0004"
/db_xref="GeneID:7278619"
CDS complement(8972..9094)
/locus_tag="HAPS_0004"
/codon_start=1
/transl_table=11
/product="hypothetical protein"
/protein_id="YP_002474657.1"
/db_xref="GI:219870282"
/db_xref="GeneID:7278619"
/translation="MYYKALAHFLPTLSTMQNILSKSPLSLDFRLLFLAFIDKR"
gene 68..637
/locus_tag="HPNK_00040"
CDS 68..637
/locus_tag="HPNK_00040"
/codon_start=1
/transl_table=11
/product="NinG recombination protein/bacteriophage lambda
NinG family protein"
/protein_id="CRESA:HPNK_00040"
/translation="MIKPKVKKRKCKCCGGEFKSADSFRKWCSAECGVKLAKIAQEKA
RQKAIEKRNREERAKIKATRERLKSRSEWLKDAQAIFNEYIRLRDKDEPCISCRRFHQ
GQYHAGHYRTVKAMPELRFNEDNVHKQCSACNNHLSGNITEYRINLVRKIGAERVEAL
ESYHPPVKWSVEDCKEIIKTYRAKIKELK"
. Soluzione
Come il tuo file Genbank di esempio è stato incompleto, sono andato online per trovare un file di esempio che potrebbe essere utilizzato in un esempio, e ho trovato Questo file .
Usando questo codice e Bio::GenBankParser
Modulo, è stato analizzato indovinare quali parti della struttura che eri dopo. In questo caso, "Caratteristiche" che conteneva sia un campo locus_tag
che un campo product
.
use strict;
use warnings;
use feature 'say';
use Bio::GenBankParser;
my $file = shift;
my $parser = Bio::GenBankParser->new( file => $file );
while ( my $seq = $parser->next_seq ) {
my $feat = $seq->{'FEATURES'};
for my $f (@$feat) {
my $tag = $f->{'feature'}{'locus_tag'};
my $prod = $f->{'feature'}{'product'};
if (defined $tag and defined $prod) {
say join "\t", $tag, $prod;
}
}
}
.
Uso:
perl script.pl input.txt > output.txt
.
Uscita:
MG_001 DNA polymerase III, beta subunit
MG_470 CobQ/CobB/MinD/ParA nucleotide binding domain-containing protein
.
L'uscita dal tuo liner per lo stesso ingresso sarebbe:
MG_001 DNA polymerase III, beta subunit
MG_470 CobQ/CobB/MinD/ParA nucleotide binding
domain-containing protein
.
Supponendo naturalmente che si aggiunge il modificatore /s
al regex per spiegare le voci multilinea (che leeduhem sottolineato I commenti):
m!/(?:locus_tag|product)="(.+?)"!sg
# ^---- this
. Altri suggerimenti
Having read your duplicated question http://www.biostars.org/p/94164/ (please don't double post like this), here's a minimal Biopython answer:
import sys
from Bio import SeqIO
filename = sys.argv[1] # Takes first command line argument input filename
for record in SeqIO.parse(filename, "genbank"):
for feature in record.features:
if feature.type == "CDS":
locus_tag = feature.qualifiers.get("locus_tag", ["???"])[0]
product = feature.qualifiers.get("product", ["???"])[0]
print("%s\t%s" % (locus_tag, product))
With minor changes you can write this out to a file instead.