Wie die ersten Treffer Elemente aus einer XML-NCBI BLAST-Datei zu extrahieren?
https://stackoverflow.com/questions/1935385
-
20-09-2019 - |
italiano
english
français
española
中国
日本の
العربية
Deutsch
한국어
Português
RussianFrage
versuchen Im nur den ersten Treffer aus einer NCBI BLAST xml-Datei zu extrahieren. nächstes würde Ich mag nur die erste HSP erhalten. in der letzten Stufe würde Ich mag diese basierend auf dem besten Punktzahl zu bekommen. Um die Dinge klar hier eine Probe der XML-Datei:
<?xml version="1.0"?>
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
<BlastOutput_program>blastx</BlastOutput_program>
<BlastOutput_version>blastx 2.2.22 [Sep-27-2009]</BlastOutput_version>
<BlastOutput_reference>~Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, ~Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), ~"Gapped BLAST and PSI-BLAST: a new generation of protein database search~programs", Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
<BlastOutput_db>/Applications/blast/db/viral1.protein.faa</BlastOutput_db>
<BlastOutput_query-ID>lcl|1_0</BlastOutput_query-ID>
<BlastOutput_query-def>DSAD-090629_plate11A01a.g1 CHROMAT_FILE: DSAD-090629_plate11A01a.g1 PHD_FILE: DSAD-090629_plate11A01a.g1.phd.1 CHEM: term DYE: big TIME: Thu Sep 17 15:33:59 2009 TEMPLATE: DSAD-090629_plate11A01a DIRECTION: rev</BlastOutput_query-def>
<BlastOutput_query-len>1024</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_matrix>BLOSUM62</Parameters_matrix>
<Parameters_expect>1e-05</Parameters_expect>
<Parameters_gap-open>11</Parameters_gap-open>
<Parameters_gap-extend>1</Parameters_gap-extend>
<Parameters_filter>F</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>lcl|1_0</Iteration_query-ID>
<Iteration_query-def>DSAD-090629_plate11A01a.g1 CHROMAT_FILE: DSAD-090629_plate11A01a.g1 PHD_FILE: DSAD-090629_plate11A01a.g1.phd.1 CHEM: term DYE: big TIME: Thu Sep 17 15:33:59 2009 TEMPLATE: DSAD-090629_plate11A01a DIRECTION: rev</Iteration_query-def>
<Iteration_query-len>1024</Iteration_query-len>
<Iteration_stat>
<Statistics>
<Statistics_db-num>68007</Statistics_db-num>
<Statistics_db-len>19518578</Statistics_db-len>
<Statistics_hsp-len>0</Statistics_hsp-len>
<Statistics_eff-space>0</Statistics_eff-space>
<Statistics_kappa>0.041</Statistics_kappa>
<Statistics_lambda>0.267</Statistics_lambda>
<Statistics_entropy>0.14</Statistics_entropy>
</Statistics>
</Iteration_stat>
<Iteration_message>No hits found</Iteration_message>
</Iteration>
<Iteration>
<Iteration>
<Iteration_iter-num>6</Iteration_iter-num>
<Iteration_query-ID>lcl|6_0</Iteration_query-ID>
<Iteration_query-def>DSAD-090629_plate11A05a.g1 CHROMAT_FILE: DSAD-090629_plate11A05a.g1 PHD_FILE: DSAD-090629_plate11A05a.g1.phd.1 CHEM: term DYE: big TIME: Thu Sep 17 15:33:59 2009 TEMPLATE: DSAD-090629_plate11A05a DIRECTION: rev</Iteration_query-def>
<Iteration_query-len>1068</Iteration_query-len>
<Iteration_hits>
<Hit>
<Hit_num>1</Hit_num>
<Hit_id>gnl|BL_ORD_ID|23609</Hit_id>
<Hit_def>gi|38707884|ref|NP_945016.1| Putative ribose-phosphate pyrophosphokinase [Enterobacteria phage Felix 01]</Hit_def>
<Hit_accession>23609</Hit_accession>
<Hit_len>293</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>49.2914</Hsp_bit-score>
<Hsp_score>116</Hsp_score>
<Hsp_evalue>5.15408e-06</Hsp_evalue>
<Hsp_query-from>580</Hsp_query-from>
<Hsp_query-to>792</Hsp_query-to>
<Hsp_hit-from>202</Hsp_hit-from>
<Hsp_hit-to>273</Hsp_hit-to>
<Hsp_query-frame>-1</Hsp_query-frame>
<Hsp_identity>26</Hsp_identity>
<Hsp_positive>45</Hsp_positive>
<Hsp_gaps>2</Hsp_gaps>
<Hsp_align-len>73</Hsp_align-len>
<Hsp_qseq>MHIIGDVE--GRTCILVDDMVDTAGTLCHAAKALKERGAAKVYAYCTHPVLSGRAIENIENSVLDELVVTNTI</Hsp_qseq>
<Hsp_hseq>MRILDDVDLTDKTVMILDDICDGGRTFVEAAKHLREAGAKRVELYVTHGIFS-KDVENLLDNGIDHIYTTNSL</Hsp_hseq>
<Hsp_midline>M I+ DV+ +T +++DD+ D T AAK L+E GA +V Y TH + S + +EN+ ++ +D + TN++</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>2</Hit_num>
<Hit_id>gnl|BL_ORD_ID|2466</Hit_id>
<Hit_def>gi|51557505|ref|YP_068339.1| large tegument protein [Suid herpesvirus 1]</Hit_def>
<Hit_accession>2466</Hit_accession>
<Hit_len>3084</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>48.9062</Hsp_bit-score>
<Hsp_score>115</Hsp_score>
<Hsp_evalue>6.70494e-06</Hsp_evalue>
<Hsp_query-from>369</Hsp_query-from>
<Hsp_query-to>875</Hsp_query-to>
<Hsp_hit-from>2312</Hsp_hit-from>
<Hsp_hit-to>2465</Hsp_hit-to>
<Hsp_query-frame>-2</Hsp_query-frame>
<Hsp_identity>52</Hsp_identity>
<Hsp_positive>70</Hsp_positive>
<Hsp_gaps>4</Hsp_gaps>
<Hsp_align-len>173</Hsp_align-len>
<Hsp_qseq>APESQEPGASTWRSSTSVVKKGQPSQK*CTSSVTSKAVPASWSTTWSTLPAPCATPPKR*KSAAPPRSTPTAPTRCCPAAPSRTSRIPSWTSWWSPTPSRCPLRRSPARVFASSTSPR-SSPKRSAASATKNRSAP---CSAKRNWPDHTAPPRAGLFALPPEAGRKPQGGLV</Hsp_qseq>
<Hsp_hseq>APPAQKPPAQPATAAATTAPKATPQTQPPTRAQTQTAPPPPSAAT-----AAAQVPPQ------PPSSQPAAKPRGAPPAPPAPP--PPSAQTTLPRPAAPPAPPPPS---AQTTLPRPAPPPPSAPAATPTPPAPGPAPSAKKSDGDRIVEPKAG---APPDVRDAKFGGKV</Hsp_hseq>
<Hsp_midline>AP +Q+P A ++ + K P + T + T A P + T A PP+ PP S P A R P AP P P P+ P P+ A +T PR + P SA +AT AP SAK++ D P+AG PP+ GG V</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>68007</Statistics_db-num>
<Statistics_db-len>19518578</Statistics_db-len>
<Statistics_hsp-len>0</Statistics_hsp-len>
<Statistics_eff-space>0</Statistics_eff-space>
<Statistics_kappa>0.041</Statistics_kappa>
<Statistics_lambda>0.267</Statistics_lambda>
<Statistics_entropy>0.14</Statistics_entropy>
</Statistics>
</Iteration_stat>
</Iteration>
im Grunde jede Abfrage Such erstellt ein Element Iteration. jeder Iteration können mehrere Treffer haben, die wiederum mehrere HSPs haben kann. Ich möchte nur den ersten Treffer bekommen und es ist zuerst HSP aus jeder Iteration. wenn der BLAST keine Treffer gefunden würde Ich mag die Iteration ignorieren. Ich arbeitete mit diesem einfachen Code auf:
#!/usr/bin/env python
from elementtree.ElementTree import parse
from elementtree import ElementTree as ET
file = open("/Applications/blast/blanes_viral_nr_results.xml", "r")
save_file = open("/Applications/blast/Blast_parse_ET.txt", 'w')
tree = parse(file)
elem = tree.getroot()
print elem
Per_ID = ()
save_file.write('>%s\t%s\t%s\t%s\t%s\t%s\t\n\n\n\n' % ("It_Num\t", "It_ID\t", "Hit_Def\t", "Num\t", "ID\t", "ACC\t"))
iteration = tree.findall('BlastOutput_iterations/Iteration')
for iteration in iteration:
for hit in iteration.findall('Iteration_hits/Hit'):
It_Num = iteration.findtext('Iteration_iter-num')
It_ID = iteration.findtext('Iteration_query-def')
Hit_Def = hit.findtext('Hit_def')
Num = hit.findtext('Hit_num')
ID = hit.findtext('Hit_id')
DEF = hit.findtext('Hit_def')
ACC = hit.findtext('Hit_accession')
save_file.write('>%s\t%s\t%s\t%s\t%s\t%s\t' % (It_Num, It_ID[12:26], Hit_Def[1:10], Num, ID, ACC,))
for hsp in hit.findall('Hit_hsps'):
HSPN = hsp.findtext('Hsp/Hsp_num')
identities = hsp.findtext('Hsp/Hsp_identity')
#print 'id: ', identities.rjust(4),
length = hsp.findtext('Hsp/Hsp_align-len')
#print 'len:', length.rjust(4),
Per_ID = int(identities) * 100.0 / int(length)
#print hsp.findtext('Hsp/Hsp_qseq')[:50]
#print hsp.findtext('Hsp/Hsp_midline')[:50]
#print hsp.findtext('Hsp/Hsp_hseq')[:50]
save_file.write('%s\t%s\t%s\%st\n' % ('***', '%', HSPN, Per_ID))
save_file.write('n\n' % ())
jede Hilfe sehr appriciated würde!
Lösung
Während Sie Ihre eigenen Parser baut sein kann „Spaß“ gibt es bereits ein Paket gibt, die BLAST XML-Dateien analysieren kann ... es kann sogar die Zwischen Aufruf einer lokalen BLAST-Instanz für Sie tun, wenn Sie dies wünschen.
Die Haupt-Website ist hier: http://biopython.org/wiki/Biopython
und der XML-Parser BLAST ist hier: http://biopython.org/DIST/docs/tutorial/Tutorial.html# htoc82
So etwas wie:
from Bio.Blast import NCBIXML
with open('xml/results/file') as handle:
all_records = NCBIXML.parse(handle)
first_record = all_records.next()
Should Arbeit. Ich liebe im Allgemeinen der biopython Parser und Schriftsteller, aber ich weiß nicht, wie die Klassenstruktur Organisation. So im Allgemeinen verwende ich nur den Parser und extrahieren Sie die Informationen, die ich in meine eigene Struktur brauchen. YMMV
Ich hoffe, das hilft.
Andere Tipps
Ich werde zweite, was JudoWill vorgeschlagen - Arbeit intelligenter, nicht härter mit dem biopython Parser. Dies sollten Sie ein wenig bekommen weiter:
from Bio.Blast import NCBIXML
blast = NCBIXML.parse(open('results.xml','rU'))
for record in blast:
if record.alignments:
# to print the "best" matches e-score
print record.alignments[0].hsps[0].expect
# to print the "best" matches bit-score
print record.alignments[0].hsps[0].score
break
Dies wird nach der ersten Abfrage stoppen (die erste und beste Übereinstimmung Rückkehr). Da ich vermute, können Sie die Ergebnisse für andere Abfragen in derselben Datei möchten, entfernen Sie einfach das break von der letzten Zeile.
Wenn ich Ihre Grundvoraussetzung verstehen dann wollen Sie die Top-Hit / HSP der Abfrage Protein / Nukleotid sequence.Why erhalten müssen Sie nicht den Standalone-Explosion auf Ihrem System mit formatiert nr installieren / nt-Datenbank. Geben Sie die Optionen
blastall -p {blast programme blastp for protein,blastn for nucleotide} -d {database} -i {input query} -v 1{for top hit} -b 1{alignment of the top hit with query} -m 7{xml blast output} -o example.xml
Öffnen Sie die XML-Ausgabedatei in MS Excel, wo Sie eine tabellarische Form der blastoutput mit Top-Single-Hit zu jeder Abfragesequenz sehen
